Protein Info for ECOLIN_RS18470 in Escherichia coli Nissle 1917

Annotation: TIGR01212 family radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR01212: radical SAM protein, TIGR01212 family" amino acids 6 to 301 (296 residues), 470 bits, see alignment E=1.5e-145 PF04055: Radical_SAM" amino acids 43 to 202 (160 residues), 70.8 bits, see alignment E=1.6e-23 PF16199: Radical_SAM_C" amino acids 208 to 290 (83 residues), 68.5 bits, see alignment E=4.4e-23

Best Hits

Swiss-Prot: 99% identical to YHCC_ECOLI: Protein YhcC (yhcC) from Escherichia coli (strain K12)

KEGG orthology group: K07139, (no description) (inferred from 99% identity to eco:b3211)

Predicted SEED Role

"COG1242: Predicted Fe-S oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ECOLIN_RS18470 TIGR01212 family radical SAM protein (Escherichia coli Nissle 1917)
MQLQKLVNMFGGDLTRRYGQKVHKLTLHGGFSCPNRDGTIGRGGCTFCNVASFADEAQQH
RSIAEQLAHQANLVNRAKRYLAYFQAYTSTFAEVQVLRSMYQQAVSQANIVGLCVGTRPD
CVPDAVLDLLCEYKDQGYEVWLELGLQTAHDKTLHRINRGHDFACYQRTTQLARERGLKV
CSHLIVGLPGEGQAECLQTLERVVETGVDGIKLHPLHIVKGSIMAKAWEAGRLNGIELED
YTLTAGEMIRHTPPEVIYHRISASARRPTLLAPLWCENRWTGMVGLDRYLNEHGVQGSAL
GRPWLPPTA