Protein Info for ECOLIN_RS17875 in Escherichia coli Nissle 1917

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details PF07681: DoxX" amino acids 8 to 87 (80 residues), 76.2 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 98% identical to YQJF_ECOLI: Inner membrane protein YqjF (yqjF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b3101)

Predicted SEED Role

"Inner membrane protein YqjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>ECOLIN_RS17875 DoxX family protein (Escherichia coli Nissle 1917)
MKKLEDVGVLVARILMPILFITAGWGKITGYAGTQQYMEAMGVPGFMLPLVILLEFGGGL
AILFGFLTRTTALFTTGFTLLTAFLFHSNFAEGMNSLMFMKNLTISGGFLLLAITGPGAF
SIDRLLNKKW