Protein Info for ECOLIN_RS17360 in Escherichia coli Nissle 1917

Annotation: FCD domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00392: GntR" amino acids 11 to 71 (61 residues), 69.9 bits, see alignment E=1.1e-23 PF07729: FCD" amino acids 94 to 223 (130 residues), 79.2 bits, see alignment E=3.7e-26

Best Hits

Swiss-Prot: 38% identical to UXUR_HAEIN: Uxu operon regulator (uxuR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 99% identity to ecz:ECS88_3397)

Predicted SEED Role

"Hexuronate utilization operon transcriptional repressor ExuR" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>ECOLIN_RS17360 FCD domain-containing protein (Escherichia coli Nissle 1917)
MEQVITKRRYYDIGLQIEELLYSGVFKAGERLPSERELSERFNTSRTTIREAIIMLELKG
VLNVKQGSGIFFVDSTDKLNQKSLMPYSEIGPFELLQARQVIESNITGFAASQISFNELQ
ELKKIIGLQEKAIAAESDKFEDLDHRFHSIIAEATQNRVLIKQAAELWRAVRTENPRWKK
LNYKYLHEKHLRLQWLEDHRAIFLALQQKDSELAREASWRHLENSKNELIKIFKQDASIS
DFDDFFFAR