Protein Info for ECOLIN_RS16755 in Escherichia coli Nissle 1917

Annotation: N-acetylneuraminate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00701: DHDPS" amino acids 5 to 290 (286 residues), 314.9 bits, see alignment E=1.8e-98 TIGR00683: N-acetylneuraminate lyase" amino acids 6 to 295 (290 residues), 434.1 bits, see alignment E=1.3e-134

Best Hits

Swiss-Prot: 100% identical to NANA2_ECOL6: N-acetylneuraminate lyase 2 (nanA2) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01639, N-acetylneuraminate lyase [EC: 4.1.3.3] (inferred from 99% identity to ecq:ECED1_4911)

MetaCyc: 66% identical to N-acetylneuraminate lyase (Escherichia coli K-12 substr. MG1655)
N-acetylneuraminate lyase. [EC: 4.1.3.3]

Predicted SEED Role

"N-acetylneuraminate lyase (EC 4.1.3.3)" in subsystem Sialic Acid Metabolism (EC 4.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.3

Use Curated BLAST to search for 4.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ECOLIN_RS16755 N-acetylneuraminate lyase (Escherichia coli Nissle 1917)
MQCEFKGVISALPTPYDQSQQIDMESLRKLIRFNIEQNIKGLYVGGSTGEAFLQNVAERE
KILETVADESDGRLTLIAHVGGISTAESEVLAKAAKKYGYHAISAVTPFYYPFSFEEHCI
HYRKIIDSADGLPMVVYNIPALSGVRFSLDQINELVTIPRVCALKQTSGDLFQMEQIKRN
HPELVLYNGYDEIFASGLIAGADGGIGSTYNIMGWRYLEIFEAVKNNDVIKAKEMQVACN
QVIDTLIQSGVLAGIKTLLYYMGIINTPVCRSPFSPVKEKNLDVLSKLAERLFEEHDRNK
KMKII