Protein Info for ECOLIN_RS15220 in Escherichia coli Nissle 1917

Annotation: formate hydrogenlyase subunit HycB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 47 to 97 (51 residues), 32.2 bits, E=3.4e-11
• PF00037: Fer4
  • amino acids 76 to 98 (23 residues), 28.4 bits, see alignment (E = 3.8e-10)

Best Hits

Swiss-Prot: 100% identical to HYCB_SHIFL: Formate hydrogenlyase subunit 2 (hycB) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b2724)

MetaCyc: 100% identical to hydrogenase 3 iron-sulfur protein HycB (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 2" in subsystem Formate hydrogenase

MetaCyc Pathways

• mixed acid fermentation (16/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production V (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Protein Sequence (203 amino acids)

>ECOLIN_RS15220 formate hydrogenlyase subunit HycB (Escherichia coli Nissle 1917)
MNRFVIADSTLCIGCHTCEAACSETHRQHGLQSMPRLRVMLNEKESAPQLCHHCEDAPCA
VVCPVNAITRVDGAVQLNESLCVSCKLCGIACPFGAIEFSGSRPLDIPANANTPKAPPAP
PAPARVSTLLDWVPGIRAIAVKCDLCSFDEQGPACVRMCPTKALHLVDNTDIARVSKRKR
ELTFNTDFGDLTLFQQAQSGEAK