Protein Info for ECOLIN_RS14040 in Escherichia coli Nissle 1917

Annotation: ethanolamine utilization acetate kinase EutQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF06249: EutQ" amino acids 85 to 232 (148 residues), 229.4 bits, see alignment E=2.4e-72 PF05899: Cupin_3" amino acids 157 to 211 (55 residues), 32.4 bits, see alignment E=8.9e-12

Best Hits

Swiss-Prot: 97% identical to EUTQ_ECOLI: Ethanolamine utilization protein EutQ (eutQ) from Escherichia coli (strain K12)

KEGG orthology group: K04030, ethanolamine utilization protein EutQ (inferred from 99% identity to ecv:APECO1_4097)

MetaCyc: 87% identical to acetate kinase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Acetate kinase. [EC: 2.7.2.1, 2.7.2.15]

Predicted SEED Role

"Ethanolamine utilization protein EutQ" in subsystem Ethanolamine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.1, 2.7.2.15

Use Curated BLAST to search for 2.7.2.1 or 2.7.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>ECOLIN_RS14040 ethanolamine utilization acetate kinase EutQ (Escherichia coli Nissle 1917)
MKKLITANDIREAHARGKLAMSVVLRASIITPEAREVADLLGFTITECDESIPVTASVPA
SASADKTESQRIRETIIAQLPEGQFTESLVAQLMEKVMKEKQSLEQGALQPSFKSVTGKG
GIKVIDGSSVKFGRFDGAQPHCVGLTDLVTGDDGSSMAAGFMQWENAFFPWTLNYDEIDM
VLEGELHVRHEGETMIAKAGDVMFIPKGSSIEFGTTSSVKFLYVAWPANWQSL