Protein Info for ECOLIN_RS13660 in Escherichia coli Nissle 1917

Annotation: formyl-CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR03253: formyl-CoA transferase" amino acids 3 to 416 (414 residues), 783.1 bits, see alignment E=2.7e-240 PF02515: CoA_transf_3" amino acids 5 to 393 (389 residues), 310.7 bits, see alignment E=7.7e-97

Best Hits

Swiss-Prot: 100% identical to FCTA_ECOL6: Formyl-CoA:oxalate CoA-transferase (frc) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07749, formyl-CoA transferase [EC: 2.8.3.16] (inferred from 100% identity to eco:b2374)

MetaCyc: 100% identical to formyl-CoA transferase (Escherichia coli K-12 substr. MG1655)
Formyl-CoA transferase. [EC: 2.8.3.16]

Predicted SEED Role

"Formyl-coenzyme A transferase (EC 2.8.3.16)" (EC 2.8.3.16)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>ECOLIN_RS13660 formyl-CoA transferase (Escherichia coli Nissle 1917)
MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPSVGDVTRHQLRDIPDIDALYF
TMLNSNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLI
FGSIKGFDECSPYVNVKAYENVAQAAGGAASTTGFWDGPPLVSAAALGDSNTGMHLLIGL
LAALLHREKTGRGQRVTMSMQDAVLNLCRVKLRDQQRLDKLGYLEEYPQYPNGTFGDAVP
RGGNAGGGGQPGWILKCKGWETDPNAYIYFTIQEQNWENTCKAIGKPEWITDPAYSTAHA
RQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVE
QPLRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQELGYSDDEIAAMKQNHAI