Protein Info for ECOLIN_RS13120 in Escherichia coli Nissle 1917

Annotation: lipopolysaccharide core heptose(II)-phosphate phosphatase Ais

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00300: His_Phos_1" amino acids 56 to 127 (72 residues), 23.6 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 100% identical to AIS_ECO81: Lipopolysaccharide core heptose(II)-phosphate phosphatase (ais) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: None (inferred from 98% identity to eco:b2252)

Predicted SEED Role

"Polymyxin resistance protein PmrG; Ais protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>ECOLIN_RS13120 lipopolysaccharide core heptose(II)-phosphate phosphatase Ais (Escherichia coli Nissle 1917)
MLAFCRSSLKSKKYFIILLALAAIAGLGTHAAWSSNGLPRIDNKTLARLAQQHPVVVLFR
HAERCDRSTNQCLSDKTGITVKGTQDARELGNAFSADIPDFDLYSSNTVRTIQSATWFSA
GKKLTVDKRFLQCGNEIYSAIKDLQRKAPDKNIVIFTHNHCLTYIAKDKRDATFKPDYLD
GLVMHVEKGKVYLDGEFVNH