Protein Info for ECOLIN_RS12720 in Escherichia coli Nissle 1917

Annotation: bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00877: NLPC_P60
  • amino acids 79 to 183 (105 residues), 128.3 bits, E=5.8e-42

Best Hits

Swiss-Prot: 100% identical to MEPS_SHIFL: Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase (mepS) from Shigella flexneri

KEGG orthology group: K13694, lipoprotein Spr (inferred from 100% identity to eco:b2175)

MetaCyc: 100% identical to peptidoglycan endopeptidase/peptidoglycan L,D-carboxypeptidase (Escherichia coli K-12 substr. MG1655)
Muramoyltetrapeptide carboxypeptidase. [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]

Predicted SEED Role

"Lipoprotein spr precursor"

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• muropeptide degradation (3/4 steps found)
• peptidoglycan recycling II (7/10 steps found)
• peptidoglycan maturation (meso-diaminopimelate containing) (6/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.13

Use Curated BLAST to search for 3.4.17.13

Protein Sequence (188 amino acids)

>ECOLIN_RS12720 bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase (Escherichia coli Nissle 1917)
MVKSQPILRYILRGIPAIAVAVLLSACSANNTAKNMHPETRAVGSETSSLQASQDEFENL
VRNVDVKSRIMDQYADWKGVRYRLGGSTKKGIDCSGFVQRTFREQFGLELPRSTYEQQEM
GKSVSRSNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYNE
ARRVLSRS