Protein Info for ECOLIN_RS11575 in Escherichia coli Nissle 1917

Annotation: colibactin biosynthesis dehydrogenase ClbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 3 to 70 (68 residues), 26.2 bits, E=1.1e-09
• PF02737: 3HCDH_N
  • amino acids 3 to 183 (181 residues), 192.8 bits, E=7.8e-61
• PF00725: 3HCDH
  • amino acids 186 to 282 (97 residues), 111.7 bits, E=3e-36

Best Hits

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 100% identity to ecc:c2467)

MetaCyc: 100% identical to L-seryl-[peptidyl-carrier protein] 3-dehydrogenase ClbD (Escherichia coli IHE3034)
RXN-21123

Predicted SEED Role

"Putative 3-hydroxyacyl-coa dehydrogenase" in subsystem Polyhydroxybutyrate metabolism or n-Phenylalkanoic acid degradation

MetaCyc Pathways

• colibactin biosynthesis (24/38 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.157

Protein Sequence (289 amino acids)

>ECOLIN_RS11575 colibactin biosynthesis dehydrogenase ClbD (Escherichia coli Nissle 1917)
MMNVAVIGAGVMGTGVAHNMAQYGISTNVVDISQSQLDKCRQMIEANLRLYNFHPQHKKK
THSTAEIMENIRFTTELDDIVECDLVIENITEDIEKKNALYTRMNTICGASTVFGVNTSA
ISITALSKLMRHPENVVGVHFMNPVPLMHTVELIRGVHTAERTLNIFHHLFAQLNKTGIV
VNDSPGFVTNRAMMIFVNEAIFMVQEQIARAEDIDTLFKTCFGHKMGPLQTADLIGLDTI
LQSLQVLYESFNDDKYRPSFLLKKMVDAGYLGVKSGQGFYRYQQTYAEQ