Protein Info for ECOLIN_RS11420 in Escherichia coli Nissle 1917

Annotation: siderophore yersiniabactin receptor FyuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07715: Plug" amino acids 48 to 149 (102 residues), 55 bits, see alignment E=1.6e-18 TIGR01783: TonB-dependent siderophore receptor" amino acids 50 to 672 (623 residues), 497.9 bits, see alignment E=2.6e-153 PF00593: TonB_dep_Rec" amino acids 221 to 638 (418 residues), 155.1 bits, see alignment E=8.6e-49 PF14905: OMP_b-brl_3" amino acids 476 to 653 (178 residues), 30.4 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 100% identical to FYUA_YERPE: Pesticin receptor (fyuA) from Yersinia pestis

KEGG orthology group: None (inferred from 100% identity to eum:ECUMN_2278)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (673 amino acids)

>ECOLIN_RS11420 siderophore yersiniabactin receptor FyuA (Escherichia coli Nissle 1917)
MKMTRLYPLALGGLLLPAIANAQTSQQDESTLVVTASKQSSRSASANNVSSTVVSAPELS
DAGVTASDKLPRVLPGLNIENSGNMLFSTISLRGVSSAQDFYNPAVTLYVDGVPQLSTNT
IQALTDVQSVELLRGPQGTLYGKSAQGGIINIVTQQPDSTPRGYIEGGVSSRDSYRSKFN
LSGPIQDGLLYGSVTLLRQVDDGDMINPATGSDDLGGTRASIGNVKLRLAPDDQPWEMGF
AASRECTRATQDAYVGWNDIKGRKLSISDGSPDPYMRRCTDSQTLSGKYTTDDWVFNLIS
AWQQQHYSRTFPSGSLIVNMPQRWNQDVQELRAATLGDARTVDMVFGLYRQNTREKLNSA
YDMPTMPYLSSTGYTTAETLAAYSDLTWHLTDRFDIGGGVRFSHDKSSTQYHGSMLGNPF
GDQGKSNDDQVLGQLSAGYMLTDDWRVYTRVAQGYKPSGYNIVPTAGLDAKPFVAEKSIN
YELGTRYETADVTLQAATFYTHTKDMQLYSGPVGMQTLSNAGKADATGVELEAKWRFAPG
WSWDINGNVIRSEFTNDSELYHGNRVPFVPRYGAGSSVNGVIDTRYGALMPRLAVNLVGP
HYFDGDNQLRQGTYATLDSSLGWQATERMNISVYVDNLFDRRYRTYGYMNGSSAVAQVNM
GRTVGINTRIDFF