Protein Info for ECOLIN_RS09575 in Escherichia coli Nissle 1917

Annotation: phenylalanine--tRNA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF02912: Phe_tRNA-synt_N" amino acids 20 to 87 (68 residues), 94.4 bits, see alignment E=3.2e-31 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 38 to 327 (290 residues), 395.7 bits, see alignment E=8e-123 PF01409: tRNA-synt_2d" amino acids 91 to 326 (236 residues), 358.8 bits, see alignment E=1.5e-111

Best Hits

Swiss-Prot: 100% identical to SYFA_ECOLU: Phenylalanine--tRNA ligase alpha subunit (pheS) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 100% identity to eco:b1714)

MetaCyc: 100% identical to phenylalanine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Phenylalanine--tRNA ligase. [EC: 6.1.1.20]; 6.1.1.20 [EC: 6.1.1.20]; 3.1.1.- [EC: 6.1.1.20]

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ECOLIN_RS09575 phenylalanine--tRNA ligase subunit alpha (Escherichia coli Nissle 1917)
MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVI
NEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFF
GELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDATRLLRTQTSGVQIRTMKA
QQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQ
IRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGME
RLTMLRYGVTDLRSFFENDLRFLKQFK