Protein Info for ECOLIN_RS07595 in Escherichia coli Nissle 1917

Annotation: tryptophan synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF00290: Trp_syntA" amino acids 8 to 266 (259 residues), 349.8 bits, see alignment E=3.5e-109 TIGR00262: tryptophan synthase, alpha subunit" amino acids 8 to 263 (256 residues), 374.4 bits, see alignment E=9.5e-117

Best Hits

Swiss-Prot: 100% identical to TRPA_ECOL6: Tryptophan synthase alpha chain (trpA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 99% identity to eco:b1260)

MetaCyc: 99% identical to tryptophan synthase subunit alpha (Escherichia coli K-12 substr. MG1655)
Tryptophan synthase. [EC: 4.2.1.20]; Indole-3-glycerol-phosphate lyase. [EC: 4.2.1.20, 4.1.2.8]

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.1.2.8 or 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>ECOLIN_RS07595 tryptophan synthase subunit alpha (Escherichia coli Nissle 1917)
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAECEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS