Protein Info for ECOLIN_RS07560 in Escherichia coli Nissle 1917

Annotation: TonB system transport protein TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF16031: TonB_N" amino acids 33 to 156 (124 residues), 160.1 bits, see alignment E=4.6e-51 PF03544: TonB_C" amino acids 159 to 228 (70 residues), 71.9 bits, see alignment E=5.2e-24 TIGR01352: TonB family C-terminal domain" amino acids 160 to 232 (73 residues), 73.4 bits, see alignment E=7.5e-25

Best Hits

Swiss-Prot: 98% identical to TONB_ECOLI: Protein TonB (tonB) from Escherichia coli (strain K12)

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 100% identity to ecm:EcSMS35_1880)

MetaCyc: 98% identical to Ton complex subunit TonB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>ECOLIN_RS07560 TonB system transport protein TonB (Escherichia coli Nissle 1917)
MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVAPADLEPPQA
VQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVEQPKRDVKPVESRP
ASPFENTAPARPTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKFD
VTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ