Protein Info for ECOLIN_RS06265 in Escherichia coli Nissle 1917

Annotation: flagellar hook-associated protein FlgL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02550: flagellar hook-associated protein 3
  • amino acids 2 to 192 (191 residues), 242.9 bits, E=3.8e-76
• PF00669: Flagellin_N
  • amino acids 3 to 141 (139 residues), 143.6 bits, E=2.1e-46

Best Hits

Swiss-Prot: 98% identical to FLGL_ECOLI: Flagellar hook-associated protein 3 (flgL) from Escherichia coli (strain K12)

KEGG orthology group: K02397, flagellar hook-associated protein 3 FlgL (inferred from 98% identity to eco:b1083)

Predicted SEED Role

"Flagellar hook-associated protein FlgL" in subsystem Flagellum

Protein Sequence (317 amino acids)

>ECOLIN_RS06265 flagellar hook-associated protein FlgL (Escherichia coli Nissle 1917)
MRFSTQMMYQQNMRGITNSQAEWMKYGEQMSTGKRVVNPSDDPIAASQAVVLSQAQAQNS
QYTLARTFATQKVSLEESVLSQVTTAIQNAQEKIVYASNGTLSDDDRASLATDIQGLRDQ
LLNLANTTDGNGRYIFAGYKTETAPFSEADGDYVGGTESIKQQVDASRSMVIGHTGDKIF
DSITSNAVAEPDGSASETNLFAMLDSAIAALKTPVADSEADKETAAAALDKTNRGLKNSL
NNVLTVRAELGTQLNELESLDSLGSDRALGQTQQMSDLVDVDWNATISSYIMQQTALQAS
YKAFTDMQGLSLFQLNK