Protein Info for ECOLIN_RS02355 in Escherichia coli Nissle 1917

Annotation: shikimate kinase AroL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF00004: AAA" amino acids 6 to 34 (29 residues), 21.6 bits, see alignment 5.2e-08 PF13238: AAA_18" amino acids 6 to 121 (116 residues), 32.8 bits, see alignment E=1.9e-11 PF01202: SKI" amino acids 11 to 168 (158 residues), 166.7 bits, see alignment E=9.1e-53

Best Hits

Swiss-Prot: 100% identical to AROL_ECOL6: Shikimate kinase 2 (aroL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 100% identity to eco:b0388)

MetaCyc: 100% identical to shikimate kinase 2 (Escherichia coli K-12 substr. MG1655)
Shikimate kinase. [EC: 2.7.1.71]

Predicted SEED Role

"Shikimate kinase III (EC 2.7.1.71)" in subsystem CBSS-562.2.peg.5158 SK3 including or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.71

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>ECOLIN_RS02355 shikimate kinase AroL (Escherichia coli Nissle 1917)
MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTVAEIVEREEWAGFRAR
ETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPVSVLVNRLQAAPEEDLR
PTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISEIRSALAQTINC