Protein Info for ECOLIN_RS02265 in Escherichia coli Nissle 1917

Annotation: taurine ABC transporter permease TauC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 268 (171 residues), 88.3 bits, see alignment E=2.7e-29

Best Hits

Swiss-Prot: 97% identical to TAUC_ECOLI: Taurine transport system permease protein TauC (tauC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 98% identity to ecx:EcHS_A0431)

MetaCyc: 97% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>ECOLIN_RS02265 taurine ABC transporter permease TauC (Escherichia coli Nissle 1917)
MSVLINEKLHSHRLKWRWPLSRQVTLSIGTLAILLTVWWVVAALQLISPLFLPPPQQVLA
KLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVLIGIPVGIAMGLSPTVRGILDPIIE
LYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALAGVKSAQQVRIRAAQSLG
ASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAATRGLGFMVQSAGEFLATD
VVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ