Protein Info for ECOLIN_RS01695 in Escherichia coli Nissle 1917

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details PF00529: CusB_dom_1" amino acids 59 to 349 (291 residues), 30.5 bits, see alignment E=5.5e-11 PF13533: Biotin_lipoyl_2" amino acids 82 to 122 (41 residues), 35.8 bits, see alignment 1.1e-12 TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 195 to 415 (221 residues), 212.4 bits, see alignment E=5.6e-67 PF13437: HlyD_3" amino acids 258 to 355 (98 residues), 58.7 bits, see alignment E=1.7e-19

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to ecc:c0362)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>ECOLIN_RS01695 HlyD family type I secretion periplasmic adaptor subunit (Escherichia coli Nissle 1917)
MTEKTERNKASSEVVRQSDLALLTDVQAALQQEKHHALFLMVIFLLVLVVTFVIWAWNSP
LDEVTRGQGSIIPGSREQVIQTLDPGILKTLEVREGDIVEKGQVLLTLDDTRSSAMLRES
EARVNNLEAVRARLRAEAYSESLTFPDDVPADLRERESTVYRLRKTELAQSIAGLKQSKA
LLDKEIAMTRPIVREGAMSEVELLRMQRQSAELQLQMDEKQNKYLTEAGAELVKTEAELA
QAKENMAGRADPVERSRIRAPLRGIVKNIRVNTLGGVVSAGQDIMEIIPLEDQLLIEAYI
NPRDVAYVRTGMPALVKLTAYDYAIYGGLDGVVTLVSPDTLRDQKRPGDLKLDPNEAYYR
VLVTTSNNYLTDRNGKILPVIPGMIASVDIKTGQKSVFQYLIKPITRMKQALQER