Protein Info for ECOLIN_RS00465 in Escherichia coli Nissle 1917

Annotation: phospho-N-acetylmuramoyl-pentapeptide- transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 239 to 256 (18 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 37 to 360 (324 residues), 539.2 bits, see alignment E=2e-166 PF10555: MraY_sig1" amino acids 68 to 80 (13 residues), 24.1 bits, see alignment (E = 1.9e-09) PF00953: Glycos_transf_4" amino acids 99 to 284 (186 residues), 115.3 bits, see alignment E=2.8e-37

Best Hits

Swiss-Prot: 100% identical to MRAY_ECOL6: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 100% identity to eco:b0087)

MetaCyc: 100% identical to phospho-N-acetylmuramoyl-pentapeptide-transferase (Escherichia coli K-12 substr. MG1655)
Phospho-N-acetylmuramoyl-pentapeptide-transferase. [EC: 2.7.8.13]

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>ECOLIN_RS00465 phospho-N-acetylmuramoyl-pentapeptide- transferase (Escherichia coli Nissle 1917)
MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKLSFGQVVRND
GPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGVIGFVDDYRKV
VRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVPFFKDVMPQLGLFYILLA
YFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYLRHAGELV
IVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIMGGVFVVE
TLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR