Protein Info for ECOLIN_RS00370 in Escherichia coli Nissle 1917

Annotation: thiamine ABC transporter substrate binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01276: thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin pyrophospate-binding protein" amino acids 6 to 327 (322 residues), 641.3 bits, see alignment E=3.1e-197 TIGR01254: ABC transporter periplasmic binding protein, thiB subfamily" amino acids 18 to 321 (304 residues), 516 bits, see alignment E=3.3e-159 PF01547: SBP_bac_1" amino acids 39 to 272 (234 residues), 72.5 bits, see alignment E=9.7e-24 PF13531: SBP_bac_11" amino acids 62 to 274 (213 residues), 50.1 bits, see alignment E=4.9e-17 PF13343: SBP_bac_6" amino acids 73 to 287 (215 residues), 60.2 bits, see alignment E=3.4e-20

Best Hits

Swiss-Prot: 98% identical to THIB_ECOLI: Thiamine-binding periplasmic protein (thiB) from Escherichia coli (strain K12)

KEGG orthology group: K02064, thiamine transport system substrate-binding protein (inferred from 98% identity to eco:b0068)

MetaCyc: 98% identical to thiamine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, substrate-binding component" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ECOLIN_RS00370 thiamine ABC transporter substrate binding subunit (Escherichia coli Nissle 1917)
MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDG
VSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAEAVNVPGGWNNDTFVPF
DYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAP
QAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAATNFSEGH
YLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPA
TTLEFTPAEVAAQRQAWISEWQRAVSR