Protein Info for Dsui_3518 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details PF09842: DUF2069" amino acids 8 to 109 (102 residues), 121.2 bits, see alignment E=9.4e-40

Best Hits

KEGG orthology group: None (inferred from 64% identity to dar:Daro_3070)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLD3 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Dsui_3518 putative membrane protein (Dechlorosoma suillum PS)
MEKRLVLIASTLLIALIFLCLAWELWLAPLKPGGSWLALKAVFLLPPLFGILKGRRYTYQ
WSSLFILFYLAEGSVRVTSDQGLTQWLAGIETLLSLAFFACVVAYARLTRPSKQKAPTAG