Protein Info for Dsui_3508 in Dechlorosoma suillum PS

Annotation: exodeoxyribonuclease VII, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to EX7S_BURCC: Exodeoxyribonuclease 7 small subunit (xseB) from Burkholderia cenocepacia (strain MC0-3)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 51% identity to app:CAP2UW1_4103)

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLC3 at UniProt or InterPro

Protein Sequence (88 amino acids)

>Dsui_3508 exodeoxyribonuclease VII, small subunit (Dechlorosoma suillum PS)
MPASTSAGGQTGTPPGSPSSPSFEEALADLERIAQAMEGGNLSLEESLSAYKRGVELLKL
CQGQLADAEQRVQVLESGTLKDLNSPEA