Protein Info for Dsui_3507 in Dechlorosoma suillum PS

Annotation: ring-hydroxylating dioxygenase, large terminal subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF00355: Rieske" amino acids 54 to 121 (68 residues), 45 bits, see alignment E=8.1e-16 PF00848: Ring_hydroxyl_A" amino acids 171 to 365 (195 residues), 125.5 bits, see alignment E=2.8e-40

Best Hits

KEGG orthology group: None (inferred from 77% identity to azo:azo1201)

MetaCyc: 58% identical to putrescine 2-hydroxylase (Bordetella bronchiseptica)
1.14.13.M64 [EC: 1.14.13.M64]

Predicted SEED Role

"GbcA Glycine betaine demethylase subunit A" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.M64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLC2 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Dsui_3507 ring-hydroxylating dioxygenase, large terminal subunit (Dechlorosoma suillum PS)
MSDIASSTKLAPAVSQFPVEWYFDEKMFELEMKLFFEQGPGYVGHELMVPNVHDYRTMEW
RDHGRMLVRQPDGVYDMSNICRHRQAIMLQGSGNAEHIVCPIHRWTYDSEGSLKGAPHFP
ANPCLNLNKRKLDSWNGLLFKGPRNAQADLAGMNVAGEFDFTGYKLDRVEMHECNYNWKT
FIEVYLEDYHVVPFHPGLGNFVTCDDLTWQFGEWYSVQKVGITNLDKVGSAPYGRWQKAV
KDFYGARGEQPKQGAVWLTYYPNVMVEWYPHVLVVSTLIPQSVNKTMNVVEFYYPEEIVE
FEREFIEAEQAAYMETAIEDDDIGERMDRGRWQLLKEGRNEVGPYQSPTEDGMQHFHEFY
RRIVEPHLK