Protein Info for Dsui_3506 in Dechlorosoma suillum PS

Annotation: putative permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details PF00892: EamA" amino acids 4 to 132 (129 residues), 59.9 bits, see alignment E=1.7e-20 amino acids 143 to 269 (127 residues), 39.8 bits, see alignment E=2.7e-14

Best Hits

KEGG orthology group: None (inferred from 64% identity to dar:Daro_3057)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLC1 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Dsui_3506 putative permease, DMT superfamily (Dechlorosoma suillum PS)
MQSLWMVAAAFLFACMGVCVKLAAEAGYSPAEIVFYRNAIALALMSASMLWGRLDPRTPH
WKFQIYRGVSGFISLMLYFYAIAWLPLATAVTLNYTSPLFLALFLAGLSGARLPASLVGA
LVAGFAGVVLLLQPTFHADQLAGGLMGLASGVLAGLAYYNVRELGQKGEPEWRTVFYFSL
LSTLGAGLWMLFFRFHPLTPRGAGLLLGVGIFATLAQLAMTRAYSRGRTLVAASLAYTAV
VFASLFGMLFWGEVLSLAAWLAIAIIVLSGMAATRFSRANPAEQD