Protein Info for Dsui_3484 in Dechlorosoma suillum PS

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 70 to 95 (26 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 138 to 165 (28 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details PF01925: TauE" amino acids 9 to 246 (238 residues), 168.2 bits, see alignment E=1.2e-53

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 78% identity to dar:Daro_0479)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL99 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Dsui_3484 putative permease (Dechlorosoma suillum PS)
MDINWFLLAPAAFFAGMVDAVVGGGGLIQIPVLLSQFSQTAIPTLFGTNKVSSIAGTGAS
LWRYARAVPIPWAVVLPATLAALVGAWLGAAVVAWLPREAMRPLVLVLMLAVAIYTFRRK
DFGHSASRELVPADRWRGALLGLTIGFYDGFFGPGTGSFLIFGFVRLFGMDFLKASASAK
VINAATNLSAIAFFASHGPILWTVGLIMAACNLAGAQVGTLLALKRGAGFVRQAFLVVVA
VLIVKLAWDMLAPAA