Protein Info for Dsui_3482 in Dechlorosoma suillum PS

Annotation: Na+/H+ dicarboxylate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 72 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 296 to 344 (49 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details PF00375: SDF" amino acids 6 to 404 (399 residues), 382.3 bits, see alignment E=1.4e-118

Best Hits

Swiss-Prot: 43% identical to DCTA_DEIRA: C4-dicarboxylate transport protein (dctA) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: None (inferred from 84% identity to dar:Daro_0480)

Predicted SEED Role

"Na+/H+-dicarboxylate symporters" in subsystem Propionyl-CoA to Succinyl-CoA Module

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL97 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Dsui_3482 Na+/H+ dicarboxylate symporter (Dechlorosoma suillum PS)
MKMNKLTTWIVLAMLAGVGVGYACNTMAPDAASAKEIAGYFSILTDIFLRLIKMIIAPLI
FATLVAGLANMGDAKAVGRVGGRALGWFICASFCSLFIGLLFANVLQPGHALSVPLPESA
AGLNLKTSALNLKDFITHVFPKSIMEAMAGNEVLQILVFAVFFGLALGHLHNQAARSLVN
TMDEVVHVMLKVTDYVMRFAPFGVFGAVAGAITTNGLGMLLVFGKFMLSFYVALAALWAL
LILAGFIVLGKDVFRLIKLVRGPLLVGFSTASSESVYPKLMEQLEKFGIKTRVTGFVLPL
GYSFNLDGSMMYTTFLALFIAQAYDIPMSLTAQITMLLVLMVSSKGIAGVPRASLVVVAA
VLPMFNLPEAGLLLVLGIDHFLDMGRTVTNVLGNSIATAVVAKWEGAIDPVSEELAEAEE
SLPVPEDDSLVTAKAAA