Protein Info for Dsui_3465 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase regulating C4-dicarboxylate transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 303 to 322 (20 residues), see Phobius details PF02743: dCache_1" amino acids 54 to 229 (176 residues), 62 bits, see alignment E=9.9e-21 PF00512: HisKA" amino acids 382 to 446 (65 residues), 38.7 bits, see alignment E=1.3e-13 PF02518: HATPase_c" amino acids 492 to 598 (107 residues), 77.8 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 57% identity to dar:Daro_2150)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL80 at UniProt or InterPro

Protein Sequence (610 amino acids)

>Dsui_3465 signal transduction histidine kinase regulating C4-dicarboxylate transport system (Dechlorosoma suillum PS)
MSLPPLPAPATSSRRRLLLGTALLAACLVFGWLAYRVALTIFLDGERQNAARRLEFYALS
LEATLARYEALPGLLALEHKLHELLAQPAGSAQAKAANAYLKTAQSGAEISAAYLIDRRG
HTLAASNWDKAGSFVGHNYAFRPYFREAIKGSLGRFYGVGATTGEPGYFLAAPVRDGSHG
PIEGVVTIKVNLAPFESALARSGDTVLLADDEGVIFLAPKAEWRYRTLAPLSPLARERLA
ASRKYGDSPLEPLISDRALEDGSVRLAVTDRRPRDLLMESQAVGHQGWRVVLLTDPAEAR
RSALGAGFTAAFALAFVLALAAHQNLRRKRRAELHQAHAALEAAIAERTADLTRKVEALK
QAEAILRQTRDTAVQAGKLAVLGQMSAGMSHELNQPLAALQTFSDNAVALMDLGRLEEVR
ENLAMIRQLTARLGRIVTQLKSFSRKGPAEKSPVPVARAVDNALLILEPRRRELQAAIQV
APIAPELAVLADTTRLEQVLVNLLRNGLDAMQERPAPRLHLQAERRDSQVRIAIRDEGPG
LPPEVLAHLFEPFYTTKPVGEGLGLGLAISLAIVEGFGGRLEGSNRPEGGAEFAIILEAA
SGTQPNPTPA