Protein Info for Dsui_3458 in Dechlorosoma suillum PS

Annotation: septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01222: septum site-determining protein MinC" amino acids 11 to 275 (265 residues), 186.3 bits, see alignment E=3.6e-59 PF05209: MinC_N" amino acids 11 to 84 (74 residues), 44.8 bits, see alignment E=1.1e-15 PF03775: MinC_C" amino acids 172 to 272 (101 residues), 105 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 42% identical to MINC_BORPA: Probable septum site-determining protein MinC (minC) from Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 42% identity to bpe:BP3227)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL73 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Dsui_3458 septum site-determining protein MinC (Dechlorosoma suillum PS)
MKSAPKSVPLLEIKGTTLAMTVLQAALRSADLPSLADSLTDQYGPSSDFFSFEPTVIDLG
ELPADIELDWAGLLPLLRRYQVAPIGVRNASPAQAEAARNVGLIVVEEAETQVRHSPRRA
EAETPAAPAAPTAAAAAPAQAELDIAPANAPANEAPAAAPAAEAAPSGTLVLDKPLRSGQ
QVYARGGDLVVLAMVSPGAEVIADGNIHIYAPLRGRALAGARGDANARIFTTCFEAELTS
VAGVYRTFEPGSEKSLTGKPVQIRLEGEKLVLEALKTS