Protein Info for Dsui_3437 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1010 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details PF08447: PAS_3" amino acids 347 to 433 (87 residues), 42.2 bits, see alignment E=2.8e-14 amino acids 475 to 564 (90 residues), 95.6 bits, see alignment E=6e-31 amino acids 735 to 818 (84 residues), 29.8 bits, see alignment E=2.1e-10 TIGR00229: PAS domain S-box protein" amino acids 450 to 576 (127 residues), 55.4 bits, see alignment E=6.7e-19 amino acids 709 to 831 (123 residues), 74.3 bits, see alignment E=9.2e-25 PF13426: PAS_9" amino acids 476 to 568 (93 residues), 22.3 bits, see alignment E=4.7e-08 amino acids 593 to 702 (110 residues), 20.8 bits, see alignment E=1.3e-07 amino acids 723 to 824 (102 residues), 61.3 bits, see alignment E=3.2e-20 PF08448: PAS_4" amino acids 477 to 572 (96 residues), 24 bits, see alignment E=1.3e-08 amino acids 718 to 827 (110 residues), 38.4 bits, see alignment E=4.4e-13 PF00989: PAS" amino acids 713 to 822 (110 residues), 58.2 bits, see alignment E=2.8e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 834 to 992 (159 residues), 149.1 bits, see alignment E=9.9e-48 PF00990: GGDEF" amino acids 836 to 992 (157 residues), 168.7 bits, see alignment E=3.2e-53

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKM7 at UniProt or InterPro

Protein Sequence (1010 amino acids)

>Dsui_3437 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MPKPLFPGRRWPVALLLMVAAALALIWTFLLRENRLFAEERQQRFEAERWVVADLVAENL
LRQLQRLDDVLLLLRSEYVAERKSVDTTIALLRQGSLQELGARVTVIDRDGYVATSDAPR
RPGERVYLGDRDNYIHFSSGGRDSLYISGPVQGRMTGAPGVQLSRPIFDARGQFAGVVAF
FMEPRQLTAFVQHQDLGPDGVLTLYSAAGKVLGRSREMEKHLGKQLSDELFGPFKKSSHG
LVTRVSALDGITRTVAYRWLDRYPMLVMVAVSPRGLEEELLAQRNANLRKGMLLSLLVLL
CGGAVAFYQLRRDRLETMLARERGHFIEAQRVANLGSWERDIPGNQVWWSDETYRILGYL
PESQKPSLQAFLARVNPRDRKRIEVNFAQVREQGGSLDIACRLLLPGNVERYVHLGGRAE
RDGSGRPSRLTGTLQDVTDYMNMQQALADAEERWKFALDGADAGVWDWFVADNRAYFSPR
WKAILGYRDEELPSRHEEWLERLHPDDRERAMAAVTDHFAGRTPVYEMEFRLRHKDGNYR
WVLSRGKVCARDPEGRPLRMLGIISDISARKQAELDLARSEAMQRSLVSAMAEGVVVQDQ
AGKIISANASARRILRIGENLVGLDSTDPEWQAVREDGSPFPGCDHPAMVTLRTGVSCDN
IIMGLHRPDAGLIWLSVNSRPLNFADERQPFAVVTSFADITEIKAAELSSRIYRDVLERA
GRAILITDGDGTINNVNSAFVSLLGYSREECLGRRTGFFRSNRHSPEFFSRMWQALKTRG
EWRGEIWNRRKTGEAILVELDVRSVTDAQGGVRQFVAVYQDVTELRRSQEEMWRLAHHDP
LTGLPNRSLFLERLDQALAHARRQGERLGLLYMDLDGFKSVNDTYGHQAGDTVLQEVGRR
LQNAVRTSDTVARLAGDEFAVLLAHLSVEDDLERVMGEIENAVARPVMWQGQELRVGVSI
GSAVFPDQADVAESLIGAADQAMYLAKQQHRQAAGPGGAPSPSLQSLHST