Protein Info for Dsui_3412 in Dechlorosoma suillum PS

Annotation: putative signal transduction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF08668: HDOD" amino acids 36 to 231 (196 residues), 134.7 bits, see alignment E=3e-43 PF01966: HD" amino acids 135 to 248 (114 residues), 27.6 bits, see alignment E=3e-10

Best Hits

KEGG orthology group: None (inferred from 58% identity to dar:Daro_3312)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKK3 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Dsui_3412 putative signal transduction protein (Dechlorosoma suillum PS)
MTSSASAAATVESVPESRLQKDEKTLQRLLSQGVKLPPQPKVVEELERLLRSDEADLRAL
ARVISQDAGITAMLFKAVQSSAYRQHQPFDNLEKILQAIGLKQTLNLVQAIALMGANKVS
KHRKAYERFWSRSQTIAQLAMLIADERVMVCNVFPDQAYLAGIFHDCGVPLLMERFPSYC
RAMHLEENDTWIDLLEEDKKYQADHCVVGYFVARHWHLPEFICEAIRFHHDLPQLVPGDS
RSLAAIIQLAIHAYHQYLHLDDPDWGRVVEDVQEELGIHADDLPEYLDVLLERFQHQS