Protein Info for Dsui_3395 in Dechlorosoma suillum PS

Annotation: arabinose efflux permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 132 (26 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 287 to 323 (37 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 317 (296 residues), 105.1 bits, see alignment E=3.9e-34 PF06779: MFS_4" amino acids 33 to 381 (349 residues), 28.5 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 63% identical to YGAY_ECOLI: Putative uncharacterized transporter YgaY (ygaY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 64% identity to ent:Ent638_3161)

Predicted SEED Role

"MFS permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKI6 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Dsui_3395 arabinose efflux permease family protein (Dechlorosoma suillum PS)
MSSAAAVPATPSLTPGLVPIMSVATGLAVAGNYYAQPLLPAIAREMGLSAAGAGAIVTTA
QLGYALGLLLIVPLGDLLERRRLIVVMTLLAAAGLLVTALSPSMAGVFVGTALAGLFSVV
AQVLVPLAATLAAPAQRGKVVGTVMSGLLLGILLARTVAGALATLGGWRTVYWVGAAAMA
LAALVLARRLPRYQHSVGLSYPRLLLSVLGLFREEPSLRLRAFLGAAAFAAFSVLWTSMA
FLLAGPAYGFSEVTIGLFGLAGAAGALAASAVGHLADRGHGDRATTLGWWLLLLSWGALY
FAPLSLVALILGVLALDLAVQGVHVSNQGAIYRIRPEARNRLTAAYMTCYFIGGAAGSLV
SAAAYGAAGWSGVCLCGGIVSLAGLAAWLGGSRLHKAVSGA