Protein Info for Dsui_3389 in Dechlorosoma suillum PS

Annotation: enoyl-CoA hydratase/carnithine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00378: ECH_1" amino acids 10 to 258 (249 residues), 128.5 bits, see alignment E=2.9e-41 PF16113: ECH_2" amino acids 13 to 194 (182 residues), 60.1 bits, see alignment E=2.8e-20

Best Hits

Swiss-Prot: 44% identical to SCPB_ECOLI: Methylmalonyl-CoA decarboxylase (scpB) from Escherichia coli (strain K12)

KEGG orthology group: K11264, methylmalonyl-CoA decarboxylase [EC: 4.1.1.41] (inferred from 67% identity to lch:Lcho_2461)

MetaCyc: 44% identical to methylmalonyl-CoA decarboxylase (Escherichia coli K-12 substr. MG1655)
4.1.1.M5 [EC: 4.1.1.M5]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.1.1.41 or 4.1.1.M5 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKI0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Dsui_3389 enoyl-CoA hydratase/carnithine racemase (Dechlorosoma suillum PS)
MSLINAHLAEGIGSITFNYDFKRNALSEAMTGEIAAALALFTQEGARVAVIRGQPGAKVW
SAGHSVDELPTGGHDPLGWKDSLRMVIREIEAFPGPVIAQVGGSVWGGACELVFACDLIV
ATPEATFAATPAKLGVAYNATGLLTFLNALPLHLAKELLFTGSPMGAARLERQGVINHLV
PAAEIDAFVHELAKGMAHNAPLSISVIKEQLRILAGAHALSPQDFERIQGLRRVVYNSAD
YAEGIHAFKQKRKPIYRGQ