Protein Info for Dsui_3388 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 44 to 76 (33 residues), see Phobius details amino acids 84 to 90 (7 residues), see Phobius details amino acids 92 to 92 (1 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 173 to 189 (17 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 335 to 359 (25 residues), see Phobius details amino acids 366 to 390 (25 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 68% identity to app:CAP2UW1_0553)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKH9 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Dsui_3388 hypothetical protein (Dechlorosoma suillum PS)
MLSTLSRPGARSLGLLALCLAFPLSAWADGPVLVAGIPLDFILFGLTLLGVALFHNYTLY
VGLTGVTVISLYKIFVTGFKTGLGFAGFAAHLGHEFVTLSNLLCLLMGFALLSRHFEKSH
VPVILPKYLPGEWKGGFVLLVMVFVLSSFLDNIAAALIGGAMAHQLFRGKVHVGYLAGIV
AASNAGGSGSVVGDTTTTMMWIDGVPPHIVLDAYVAAIVALLIVAFVASRQQHAYSPIIK
GGHQHTKIDWARVGIVGMILAFAIGANVLVNINFPEEADHFPFIGVAVWLAILISTSIRR
PDWEVLPETFKGSIFLLSLVTCASMMPVEELPGASWQTALGLGFVSAVFDNIPLTALALK
QGGYDWGFLAYAVGFGGSMVWFGSSAGVALSNMFPEAKSVGNWLRHGWHVALAYVVGFFV
LLTVLGWHPDADHKAPAAVEAAAAAAVPAEAAAKP