Protein Info for Dsui_3339 in Dechlorosoma suillum PS

Annotation: branched-chain amino acid aminotransferase, group I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 68% identical to ILVE_PSEAE: Branched-chain-amino-acid aminotransferase (ilvE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00826, branched-chain amino acid aminotransferase [EC: 2.6.1.42] (inferred from 92% identity to dar:Daro_3294)

MetaCyc: 68% identical to branched-chain-amino-acid aminotransferase subunit (Pseudomonas aeruginosa)
Branched-chain-amino-acid transaminase. [EC: 2.6.1.42, 2.6.1.6]; 2.6.1.42 [EC: 2.6.1.42, 2.6.1.6]; 2.6.1.42 [EC: 2.6.1.42, 2.6.1.6]

Predicted SEED Role

"Branched-chain amino acid aminotransferase (EC 2.6.1.42)" in subsystem Alanine biosynthesis or Branched-Chain Amino Acid Biosynthesis or Isoleucine degradation or Leucine Biosynthesis or Leucine Degradation and HMG-CoA Metabolism or Pyruvate Alanine Serine Interconversions or Valine degradation (EC 2.6.1.42)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
L-leucine biosynthesis (6/6 steps found)
L-valine biosynthesis (4/4 steps found)
superpathway of L-alanine biosynthesis (4/4 steps found)
L-leucine degradation I (5/6 steps found)
L-alanine biosynthesis I (2/2 steps found)
L-isoleucine biosynthesis V (2/3 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-valine degradation II (2/3 steps found)
L-isoleucine biosynthesis IV (4/6 steps found)
L-isoleucine degradation I (4/6 steps found)
anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
L-isoleucine biosynthesis II (5/8 steps found)
L-isoleucine biosynthesis III (4/7 steps found)
L-isoleucine degradation III (oxidative Stickland reaction) (1/3 steps found)
L-leucine degradation V (oxidative Stickland reaction) (1/3 steps found)
L-valine degradation III (oxidative Stickland reaction) (1/3 steps found)
superpathway of L-threonine metabolism (11/18 steps found)
L-leucine degradation IV (reductive Stickland reaction) (1/5 steps found)
L-valine degradation I (3/8 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.42

Use Curated BLAST to search for 2.6.1.42 or 2.6.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJZ0 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Dsui_3339 branched-chain amino acid aminotransferase, group I (Dechlorosoma suillum PS)
MSMSDRDGFIWQDGKLVPWREATTHALTHSLHYGMAVFEGVRAYQTDKGTAIFRLQDHTQ
RLARSAHIFQMALPYSQEELNEAQKEVIRANNLESGYIRPLAFYGSEKMGVSPKGAKVHV
IIAAWPWGAYLGEEGMQRGIRIKTSSFTRHHVNITMVRAKASGNYMNSILANNEALTDGY
DEAMLLDPEGYVCEGAGENIFIVKNGKLYTPDLTSCLEGITRATVIQLAGEMGIEVVEKR
ITRDEVYCADEAFFTGTAAEVTPIRELDNRQIGVGHRGPVTKALQEKYFDVVNGRSAAHA
DWLAFV