Protein Info for Dsui_3338 in Dechlorosoma suillum PS

Annotation: Zn-finger containing NTP pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF00293: NUDIX" amino acids 8 to 125 (118 residues), 56.4 bits, see alignment E=1.6e-19

Best Hits

KEGG orthology group: None (inferred from 73% identity to tmz:Tmz1t_1210)

Predicted SEED Role

"Nudix-like NDP and NTP phosphohydrolase YmfB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJY9 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Dsui_3338 Zn-finger containing NTP pyrophosphohydrolase (Dechlorosoma suillum PS)
MAPVWKPNVTVAAVVERDGRFLLVEEETDDGLRFNQPAGHLDEGESLVHACARECLEETA
YRFRPTALVGIYQWPRPAGDITYLRFAFTGEIEGFEEGRALDTGIIGARWLTLEEVRATA
ERHRSPLILRCIEDYVAGKRHPLDLITHYS