Protein Info for Dsui_3334 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 879 PF00072: Response_reg" amino acids 19 to 130 (112 residues), 87.8 bits, see alignment E=2e-28 amino acids 748 to 858 (111 residues), 81.8 bits, see alignment E=1.5e-26 PF13188: PAS_8" amino acids 177 to 222 (46 residues), 20.2 bits, see alignment 1.5e-07 PF00989: PAS" amino acids 178 to 293 (116 residues), 55.2 bits, see alignment E=2.4e-18 TIGR00229: PAS domain S-box protein" amino acids 178 to 303 (126 residues), 58.3 bits, see alignment E=8.7e-20 PF08448: PAS_4" amino acids 184 to 298 (115 residues), 40.6 bits, see alignment E=9.2e-14 PF13426: PAS_9" amino acids 188 to 294 (107 residues), 44.5 bits, see alignment E=5.7e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 303 to 465 (163 residues), 137.1 bits, see alignment E=4.8e-44 PF00990: GGDEF" amino acids 308 to 463 (156 residues), 158.5 bits, see alignment E=4.2e-50 PF00563: EAL" amino acids 484 to 717 (234 residues), 247 bits, see alignment E=6e-77

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJY5 at UniProt or InterPro

Protein Sequence (879 amino acids)

>Dsui_3334 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MIENDLPEAGGAPLHQETVLVVDDTKENLTVIGELLNPHYNVRIANSGQRALKVANSTPV
PDLILLDIMMPEMDGYETLAELRANPATRHIPVIFVTALDADEDEERGLALGAVDYIAKP
IRPAILLGRIRTQLDLKLAQDQLRRQNASLEAEVQRRVAENLAIQEQGQRNEARLNRMRQ
LILSSASEGIFGVDVEGRINFINPAATALLGYTEEELLGQDSHRMLHHSHIDGSHYAVED
CPMHLCLHSGITIRDRESTLWHRDGTPLPLECSHTPIVEDGRIIGAVTTLRDIRDRKRYL
EQLERHSNYDELTDLPNRNLLYDRLNHNIEVCRRSGMNIAVLTLNLDRFKSINDTLGRAA
GDQVLREVAQRLGRQVRKMDTLARLEGDEFVLVVEVATAEQSSAFAQPILKALANPFHVA
EREFFLSGSIGIATFPKDGDNGEELLRNADAAMYKAKTKGGNRFQFYTAEMNQRSLERLD
LENGLRRAIDQGELVVYYQPQVNLRNGAIIGAEALVRWQDPEKGLVMPGSFIALAEETGL
IVPLGEWVLRTACSQNKAWQDAGLPKIPVAVNLSARQFAAQDVVELAARILHDTGLAPNY
LELELTESAVMADAEAFIRATEKLKGLSIALSIDDFGTGFSSLSYLKRFAIDRLKIDQTF
VRDITHDPDSASIALAIISLAHSLKLLAIAEGVETEAQLNFLRARNCDEMQGYFFSPALP
ADEFEAMLRQGRKLEFQPESKVPGRTLLLVDDEPGILSALKRLFRREGYVILTANSGKEG
LDILAGHDVGVIISDARMPEMDGAEFLGKVRAMYPDTMRIILSGYTDLKAVTSAVNRGEL
FKFLTKPWDDGELLETIRDAFRQYEMRKPPPADGAAPEH