Protein Info for Dsui_3332 in Dechlorosoma suillum PS

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF13417: GST_N_3" amino acids 3 to 75 (73 residues), 58.2 bits, see alignment E=2.5e-19 PF02798: GST_N" amino acids 3 to 72 (70 residues), 37.1 bits, see alignment E=1e-12 PF13409: GST_N_2" amino acids 8 to 72 (65 residues), 69.2 bits, see alignment E=1.1e-22 PF00043: GST_C" amino acids 108 to 193 (86 residues), 33.5 bits, see alignment E=1.3e-11 PF14497: GST_C_3" amino acids 110 to 194 (85 residues), 32.7 bits, see alignment E=2.2e-11 PF13410: GST_C_2" amino acids 121 to 184 (64 residues), 58.8 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 71% identity to dar:Daro_3289)

Predicted SEED Role

"Glutathione S-transferase family protein" in subsystem Glutathione: Non-redox reactions

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJY3 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Dsui_3332 glutathione S-transferase (Dechlorosoma suillum PS)
MKLIGSYTSPFVRKVRVVLAEKKIEAEFEIESPWTPESRVPEHNPLGKIPVLLLDDGTPL
FDSRVIVEYLDNVTPNNKLMPAPNRERMEVKRWEALADGLLEAAVATFLEGKRPKQKQDG
ATIARQREKIQRTLDYMAKELGENPWCMGTHFSLADIAVGVALGYLDFRFADIEWRPAYP
GLARIHEKLMQRPAFSDTLPHD