Protein Info for Dsui_3305 in Dechlorosoma suillum PS

Annotation: parallel beta-helix repeat (two copies)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR04247: nitrous oxide reductase family maturation protein NosD" amino acids 79 to 455 (377 residues), 374.1 bits, see alignment E=5.8e-116 PF13229: Beta_helix" amino acids 126 to 285 (160 residues), 68.6 bits, see alignment E=7.6e-23 amino acids 257 to 375 (119 residues), 45.8 bits, see alignment E=7.9e-16 PF05048: NosD" amino acids 195 to 391 (197 residues), 119.7 bits, see alignment E=1.9e-38 TIGR03804: parallel beta-helix repeat" amino acids 248 to 286 (39 residues), 26.9 bits, see alignment 2.9e-10

Best Hits

KEGG orthology group: K07218, nitrous oxidase accessory protein (inferred from 66% identity to app:CAP2UW1_3415)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJV7 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Dsui_3305 parallel beta-helix repeat (two copies) (Dechlorosoma suillum PS)
MRRLLAVAASPLLVWAAVSVAVGDPDYALRALGAATDTPAAASSADDGMGKPAGSAWGAS
GEKVPLPTAPAVAGIPWFQDLVNQAPEGSVLKVPAGSYSGPVVVNKPLTIEAQGQVIIDG
GGKGTVFVLDTSGAVLRGVHLTNSGGSHDSDDACLNVRGDRNVVDQVRITNCLFGIDLKQ
SNDNKLTRNYIRSKPFDLGLRGDGVRLWYSKNNLLEGNEIEDSRDMVAWYSDHNVFRNNV
SRRSRYSIHFMFAHENTVEGNRFYDNAVGVYLMYTKGAYIRNNTISHATGATGMAVGLKE
ASNTVIEGNEILYCSTGIGTDLSPFEPGSKTEVRKNRFAFNGIAVSFVSDREGSVFESNV
FEGNLADVAVAGGGGAAHNRWHGNYWDGYQGFDRNNDGVGDTPYEDYAYADRLWMEVPFA
LFFKSAPMMESLDFLERLAPFSDPVLMVRDEAPVFKNPRRKAP