Protein Info for Dsui_3297 in Dechlorosoma suillum PS

Annotation: nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF00881: Nitroreductase" amino acids 8 to 193 (186 residues), 83.5 bits, see alignment E=1e-27

Best Hits

Swiss-Prot: 50% identical to NFSB_SALTY: Oxygen-insensitive NAD(P)H nitroreductase (nfsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10679, nitroreductase / dihydropteridine reductase [EC: 1.-.-.- 1.5.1.34] (inferred from 65% identity to dar:Daro_1868)

MetaCyc: 48% identical to NAD(P)H-dependent nitroreductase NfsB (Escherichia coli K-12 substr. MG1655)
1.7.1.-; NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]; 6,7-dihydropteridine reductase. [EC: 1.6.5.2, 1.5.1.34]

Predicted SEED Role

"Oxygen-insensitive NAD(P)H nitroreductase (EC 1.-.-.-) / Dihydropteridine reductase (EC 1.5.1.34)" in subsystem Pterin biosynthesis (EC 1.-.-.-, EC 1.5.1.34)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.5.1.34 or 1.6.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJF9 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Dsui_3297 nitroreductase (Dechlorosoma suillum PS)
MNIAQVAAQRYTTKAFDPSRKIAADDLAALRTLLRNAPSSVNSQPWHFVIAGSDAAKGRI
AATLTADFPYNEPKVRNASQVVVLCARESLDEGHLAAILAQEEADGRFANAEAKAAQAKG
RAFYVGLHQQQLQDEAAWMDRQVYLALGTLLLGAGALGIDACPIEGFSPEAVDEALGLKA
KGLRSRVMVALGYRSEDDFNARLPKSRLPESAVISEI