Protein Info for Dsui_3286 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF00072: Response_reg" amino acids 24 to 133 (110 residues), 92.1 bits, see alignment E=1.1e-29 PF00158: Sigma54_activat" amino acids 163 to 329 (167 residues), 237.1 bits, see alignment E=3.6e-74 PF14532: Sigma54_activ_2" amino acids 164 to 334 (171 residues), 66.3 bits, see alignment E=1.5e-21 PF01078: Mg_chelatase" amino acids 186 to 305 (120 residues), 26.3 bits, see alignment E=1.8e-09 PF00004: AAA" amino acids 187 to 317 (131 residues), 26.5 bits, see alignment E=3.2e-09 PF07728: AAA_5" amino acids 187 to 307 (121 residues), 42.8 bits, see alignment E=2.1e-14 PF25601: AAA_lid_14" amino acids 335 to 393 (59 residues), 57.9 bits, see alignment E=3e-19 PF02954: HTH_8" amino acids 419 to 456 (38 residues), 46.3 bits, see alignment 1.2e-15

Best Hits

KEGG orthology group: None (inferred from 75% identity to azo:azo0071)

Predicted SEED Role

"Sigma-54 dependent response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJE8 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Dsui_3286 response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Dechlorosoma suillum PS)
MAFIPETPGSESPDPADRPAEPTVLVVDDEEGMRSFLTRTLALRGWQVEAAASAEEGAAQ
LAGRHFDLIILDIALPGKSGLEWLKDLKAAGFAGDVILITAFADMETAIDALRAGASDFV
LKPFRVDQIVNSINRCFERARLARENFVLRRQLEERGGARDEIVGHSDSIARLRALVRRV
APTPSTVLIQGESGVGKELVARALHQLSPRASRPFVAVNCAAISADLIESELFGHVKGAF
TGAKEARNGLFYYAHGGTLFLDEIGEFPLALQSKLLRVLEERRIRPVGTEHEVPVDVRVV
AATNRDLKQEAAQCRFRQDLFYRLEVMTLTVPPLRQRAEDVPELAALFMDNLCVQLGVAP
LLITPEVAHALSAYTWPGNVRELRNFVERSLLFGEFPLDSLGSDGAAMEPAAAPPSLLLA
EVEKRHILAVLAQSNGSKARAADLLGVSRKTLDRKCAEWGV