Protein Info for Dsui_3280 in Dechlorosoma suillum PS

Annotation: formate dehydrogenase, gamma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01583: formate dehydrogenase, gamma subunit
  • amino acids 6 to 202 (197 residues), 215.2 bits, E=4.9e-68
• PF01292: Ni_hydr_CYTB
  • amino acids 8 to 183 (176 residues), 88.3 bits, E=2.8e-29

Best Hits

Swiss-Prot: 60% identical to FDOI_ECOL6: Formate dehydrogenase, cytochrome b556(fdo) subunit (fdoI) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 73% identity to cvi:CV_3841)

MetaCyc: 60% identical to formate dehydrogenase O subunit gamma (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O gamma subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• nitrate reduction III (dissimilatory) (1/2 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• superpathway of C1 compounds oxidation to CO₂ (2/12 steps found)
• purine nucleobases degradation II (anaerobic) (10/24 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

See G8QJE2 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Dsui_3280 formate dehydrogenase, gamma subunit (Dechlorosoma suillum PS)
MKEQLIQRYNAAERINHWVVAVCFILLAISGLAFFYPAFFWLTGVFGTPQLARIIHPFVG
VVMFLAFARQFFRYWHHNLVTSEDVKWMKSVKEVMKGNEVGDIGRYNGGQKGMFWVMVGC
MALLLITGVIAWRPYFALYFPIPLIRVALLVHAASALVLIASIIVHVYAALWVQGTIRAM
VEGVVTHAWAKKHHPKWYREMTGKES