Protein Info for Dsui_3272 in Dechlorosoma suillum PS

Annotation: putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 46 to 73 (28 residues), see Phobius details amino acids 76 to 76 (1 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 153 to 180 (28 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details PF01810: LysE" amino acids 16 to 210 (195 residues), 139.5 bits, see alignment E=4.9e-45

Best Hits

Swiss-Prot: 60% identical to Y4757_PSEAE: Uncharacterized membrane protein PA4757 (PA4757) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11250, leucine efflux protein (inferred from 66% identity to tmz:Tmz1t_1324)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJD5 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Dsui_3272 putative threonine efflux protein (Dechlorosoma suillum PS)
MTYGITDLATFILGTIFIVLLPGPNSMYVTLVASRWGIAAGYRGACGIFLGDLILMILAA
SGVASLLVAVPALFMVLKYAGGAYLVWLGIGLLRAAVQRWRGVEAPASRLSEGDARQPFR
TALVISLMNPKAILFFVSFFIQFVSPDYPHPALSFLILGAIVQFCSALYLSALIFGGSYL
ADAFRRRRRLSAGATGAVGGLFIGFGVKLAGASLR