Protein Info for Dsui_3271 in Dechlorosoma suillum PS

Annotation: ATP-dependent protease Clp, ATPase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00493: MCM" amino acids 9 to 130 (122 residues), 32.6 bits, see alignment E=1.9e-11 PF00158: Sigma54_activat" amino acids 38 to 130 (93 residues), 24.7 bits, see alignment E=6.7e-09 PF07724: AAA_2" amino acids 51 to 234 (184 residues), 95.2 bits, see alignment E=1.8e-30 PF00004: AAA" amino acids 54 to 160 (107 residues), 58.3 bits, see alignment E=4.7e-19 PF10431: ClpB_D2-small" amino acids 241 to 318 (78 residues), 30.7 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 69% identity to app:CAP2UW1_1951)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJD4 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Dsui_3271 ATP-dependent protease Clp, ATPase subunit (Dechlorosoma suillum PS)
MLPENATPSAIVKYLNQYVIGQEEAKRVLAVAVYAHYRKLTAAGETVRLDKSNVLIIGPT
GTGKTLLCETLSRFLQVPFVTTDATSLAQTKYVGEEIEAILLRLLEKAGGDTERAGRGIV
FIDEIDKLKARPGEAARVQATSGESVQHALLKIMEGYPVRLPDNRSIDTSGILFICGGAF
VGLEQIMEKSHSFGYIGTGEDDNQNILDRLNSRVKPTDLFEFGLIPEFTGRLPVVARFQD
LSKAMLVRVMTEPKNSLYNQFRLLLQSEGVELQIEPAVFQQIAEIAFEYKTGARSLRGIF
EELLTPVLYAVPDHKEVKKVVIKSLFEDPSYYK