Protein Info for Dsui_3263 in Dechlorosoma suillum PS

Annotation: 3-deoxy-D-manno-octulosonate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00466: 3-deoxy-D-manno-octulosonate cytidylyltransferase" amino acids 4 to 244 (241 residues), 272.5 bits, see alignment E=1.4e-85 PF02348: CTP_transf_3" amino acids 6 to 226 (221 residues), 194.7 bits, see alignment E=1.9e-61 PF12804: NTP_transf_3" amino acids 19 to 129 (111 residues), 56.4 bits, see alignment E=4.2e-19

Best Hits

Swiss-Prot: 78% identical to KDSB_DECAR: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 78% identity to dar:Daro_3206)

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJC6 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Dsui_3263 3-deoxy-D-manno-octulosonate cytidylyltransferase (Dechlorosoma suillum PS)
MQRFKVVIPARYASSRLPAKPLLDLGGKPMVVRVAERAALSGAEEIWVATDHREVEAACR
AHGLNVLLTRDDHPTGTDRLAEVVALRGWSDDTLVVNVQGDEPLIEPELISATANRLAES
GADIATVGHGLSEAADFFNPNIVKLVCKADGDALYFSRAPIPYARDHFAREGGGEALPTD
FPAYRHIGLYAYRAAFLKAYSGLAVSPLEQFECLEQLRALWHGYRISVAISDSLPAPGVD
TPEDAVRMRKWFDREGISE