Protein Info for Dsui_3250 in Dechlorosoma suillum PS

Annotation: acetylornithine/succinylornithine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR00707: transaminase, acetylornithine/succinylornithine family" amino acids 4 to 384 (381 residues), 471.8 bits, see alignment E=7e-146 PF00202: Aminotran_3" amino acids 10 to 382 (373 residues), 376.6 bits, see alignment E=6.6e-117

Best Hits

Swiss-Prot: 61% identical to ARGD1_BORBR: Acetylornithine aminotransferase 1 (argD1) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K00818, acetylornithine aminotransferase [EC: 2.6.1.11] (inferred from 76% identity to app:CAP2UW1_3085)

Predicted SEED Role

"Acetylornithine aminotransferase (EC 2.6.1.11)" in subsystem Arginine Biosynthesis extended (EC 2.6.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.11

Use Curated BLAST to search for 2.6.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJB3 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Dsui_3250 acetylornithine/succinylornithine aminotransferase (Dechlorosoma suillum PS)
MPHLMNTYARLPVAFSHGEGNRIYDTDGKCYLDALSGIAVNTLGHNHPKLVNAIASQAAR
VLHTSNLYRIPLQEELADRLAGLSRMEEVFFCNSGCEANEAAIKLARFFGHQKGVDAPVI
IVMEKAFHGRTLATLSATGNRKAQAGFEPLVSGFVRVPYNDLDAIRAAAELNPNVVAVLL
EMVQGEGGIHVADPEFQRGLRSLCDEKDWLLMCDEVQCGMGRTGTWFGFQHAGILPDVAT
LAKGLGSGVPIGACMTAGKAAGLFKPGNHGSTFGGNPLACAAALTTIACIEEEKLRENAV
AQGEAIRRGLSEALAGVGGLVEIRGKGLMLGIELDRPCGELVAKGLEAGLLINVTAEKVV
RLLPALTFSAADTQELVQRLAALIKEFLTA