Protein Info for Dsui_3226 in Dechlorosoma suillum PS

Annotation: putative SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF05971: Methyltransf_10" amino acids 11 to 305 (295 residues), 367.5 bits, see alignment E=2.8e-114

Best Hits

Swiss-Prot: 61% identical to RLMF_DECAR: Ribosomal RNA large subunit methyltransferase F (rlmF) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K06970, ribosomal RNA large subunit methyltransferase F [EC: 2.1.1.181] (inferred from 61% identity to dar:Daro_2875)

MetaCyc: 52% identical to 23S rRNA m6A1618 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11596 [EC: 2.1.1.181]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase F (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.181 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIU8 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Dsui_3226 putative SAM-dependent methyltransferase (Dechlorosoma suillum PS)
MTNPAAPASPKPGLHPRNRHAHGYDFATLAAITPELARFIVTTPAGSPSIDFANPKAVKA
LNKALLEADYGVSGWDIPPGYLCPPIPGRADLLHHLADMLAEGNEGRIPTGERVRVLDIG
VGANGVYPLIGHAEYGWRFVGVDTEQKSLDNVARILAANEHLAGAIELRHQPVPDNIFVG
VLRSGEKFDLTLCNPPFHASAADARFASERKQKNLGQTPGKGGSNFGGQDNELWYPGGER
AFLTRLIEQSAGIPKRALWFSALISKAENLRHVEAALAKVKPTASRIIPMSQGQKQSRLA
VWSFVGRAERQKWMLARWG