Protein Info for Dsui_3223 in Dechlorosoma suillum PS

Annotation: Zn-dependent protease with chaperone function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 65 to 87 (23 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details PF16491: Peptidase_M48_N" amino acids 25 to 204 (180 residues), 212.5 bits, see alignment E=4.3e-67 PF01435: Peptidase_M48" amino acids 207 to 411 (205 residues), 122 bits, see alignment E=2.7e-39

Best Hits

KEGG orthology group: K06013, STE24 endopeptidase [EC: 3.4.24.84] (inferred from 71% identity to dar:Daro_3002)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIU5 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Dsui_3223 Zn-dependent protease with chaperone function (Dechlorosoma suillum PS)
MTFTLVFLAALLLSLALRLGLARRQIAHVQAHRGAVPAEFSARVSLEAHQKAADYTVARN
RFGMAATLLEALVLLGFTLGGGIQALHGLWQGWLPDSPLGYGLGLIGSVTLISGAIDLPF
AWYRQFVLEERFGFNRMTPALFLTDLLKSTLLGAAIGAPVVLAVLWLMGSMGENWWLYVW
LFWSGFNLLLLFIYPTWIAPLFNKFAPLEAGELKSRIEALLARCGFAASGLFVMDGSKRS
AHGNAYFTGFGKNKRIVFFDTLLSRLSPVEAEAVLAHELGHFKRRHIVKRIALLFAMSLG
FLWLLGQLMEAPWFYAGLGVSAQNTALALILFFMVAPVFTFLLTPLSSLLSRRHEYEADA
YAVEHADGEQLVAALVKLYEDNASTLTPDPLHSLFYDSHPPAALRIAHITRLSQRRTGAG
ATA