Protein Info for Dsui_3220 in Dechlorosoma suillum PS

Annotation: PMT family glycosyltransferase, 4-amino-4-deoxy-L-arabinose transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 126 to 142 (17 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 175 to 204 (30 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIU2 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Dsui_3220 PMT family glycosyltransferase, 4-amino-4-deoxy-L-arabinose transferase (Dechlorosoma suillum PS)
MIDRHFPGPATRYPVPFRGLPLLLLLALFLLPGLVGHDPWKAEDATHLGIVWRLLQGDGG
LVLQLGRDAWPDAMPLYYWTAALAAKAFAWLLPWFDGARLATALYAALTLGFLALASREL
HGRDESASAPLLLAGCIGLLVHSHEAQPAIAFLAAQAATLAGLTLLRRHPWSGALVFGGG
ALTAFLAAGLAALPGLLLPLVLLPWLAPRKALVAPLLLLSLVLSATGPLLWSVLLTPAQA
GVWWNGELAQLRSLEAGWRNALVLLNMLPWYAWPALPLALWTLWARRREWLTAAPAPALL
LPLAAFLASFLTVVSTVDAKSVAALPLLAPLALLGAGGIKTLRRGATNLFDWFGMMTFTV
AAALIWLGWSAMVFGLPPKIARNFVKLAPGFEGSFALFPVLFALALSAAWFWLIFSSPRS
PYRGLTHWTAGVTLLWGLVAALWFPWVDYGKSYRPVVAGLTQALPAKHGCVAVRGELSPA
LKASLDIFGDLRPLPLASSEGKRCDWMLALVPVKSSGTAGTGWERVWEGARPGDKTERLR
LYQRRAG