Protein Info for Dsui_3209 in Dechlorosoma suillum PS

Annotation: putative esterase of the alpha/beta hydrolase fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF06821: Ser_hydrolase" amino acids 7 to 174 (168 residues), 198.1 bits, see alignment E=1.6e-62 PF12697: Abhydrolase_6" amino acids 9 to 152 (144 residues), 29.8 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: K07002, (no description) (inferred from 54% identity to nde:NIDE3617)

Predicted SEED Role

"Predicted esterase of the alpha/beta hydrolase fold"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIT1 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Dsui_3209 putative esterase of the alpha/beta hydrolase fold protein (Dechlorosoma suillum PS)
MSNAHPVLIVPGFGNSGPDHWQSRWQAAEPRFRRVEQQSWETPHYTDWRHALEAAVAAAP
SPPILVAHSLGCLLVSRWAEESRLPVQGALLVAPPDPQGPAFPAEARGFSPLARSALPFP
SLVVASRDDPYGHLIFAAQCAALWGSRFVDAGYCGHINADSGLGDWPWGRELLRSLEA