Protein Info for Dsui_3208 in Dechlorosoma suillum PS

Annotation: cysteine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF00291: PALP" amino acids 7 to 292 (286 residues), 254.4 bits, see alignment E=7.8e-80 TIGR01139: cysteine synthase A" amino acids 8 to 305 (298 residues), 461 bits, see alignment E=1.6e-142 TIGR01136: cysteine synthase" amino acids 8 to 305 (298 residues), 445.2 bits, see alignment E=1.2e-137

Best Hits

Swiss-Prot: 70% identical to CYSK_MYCTU: O-acetylserine sulfhydrylase (cysK1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 84% identity to dar:Daro_4128)

MetaCyc: 56% identical to O-acetylserine (thiol) lyase (Arabidopsis thaliana col)
Cysteine synthase. [EC: 2.5.1.47]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIT0 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Dsui_3208 cysteine synthase A (Dechlorosoma suillum PS)
MKIAKDVTQLVGKTPLVQLNRVAAGIEGTVALKLEYFNPAHSVKDRIAVAMIDAAQAAGK
IKPDTIVLEPTSGNTGIGLAMVCAARGIKAAFVMPETMSRERKLLLKAYGAELILTPGPE
GMGGAIKKAQELAESDSRYFIPQQFENPANPEVHRNTTAEEIWADTDGQVDIFVAGVGTG
GTVTGVGEVLKARKPGVQVFAVEPDASPVLSGGAKGPHPIQGIGAGFVPAVLNTQVYDGV
VRVKNDDAFATARRLATEEGLLVGISSGAAVWAALEIARKPENKGKLTVVVIPSFGERYL
STALYQHLEV